PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G20550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 280aa    MW: 31282.2 Da    PI: 6.1619
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G20550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.51e-1573120148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd++lv  + q G g+W+  ar  g++R +k+c++rw++yl
  LPERR01G20550.1  73 KGTWTLEEDLILVSFISQNGEGSWDNLARSAGLNRNGKSCRLRWLNYL 120
                      799*******************************************97 PP

2Myb_DNA-binding46.21e-14126169146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eEd  + +++ ++G++ W +Ia++++ gRt++++k++w++
  LPERR01G20550.1 126 RGSITPEEDVVIRELHSRWGNR-WCKIAKHLP-GRTDNEIKNYWRT 169
                      7889******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.58268120IPR017930Myb domain
SuperFamilySSF466892.02E-2971167IPR009057Homeodomain-like
SMARTSM007171.3E-1272122IPR001005SANT/Myb domain
PfamPF002498.6E-1473120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-1874126IPR009057Homeodomain-like
CDDcd001671.49E-975120No hitNo description
PROSITE profilePS5129423.283121175IPR017930Myb domain
SMARTSM007174.1E-15125173IPR001005SANT/Myb domain
PfamPF002492.6E-13126169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-23127174IPR009057Homeodomain-like
CDDcd001674.48E-12130169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MSSLVLIYIN DDGAGCPINQ DPRVQRTIDR PDPLTLLCSA LCSSARVPVI KQLLAMATRM  60
CGRVIAGEPA VRKGTWTLEE DLILVSFISQ NGEGSWDNLA RSAGLNRNGK SCRLRWLNYL  120
RPGVRRGSIT PEEDVVIREL HSRWGNRWCK IAKHLPGRTD NEIKNYWRTK IHRKPRCSRS  180
QMQEPCEDDA VVMGIDTSEA ASTTSASASS SQSQESSGAV WDGYVQTSDL GSVAGDHHHL  240
EMPGMDEVTA HFTAMEFGFN DGFWNFVDNF WETMPFSDMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-256917423127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0036071e-85AP003607.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0004A09.
GenBankAP0043671e-85AP004367.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0696E01.
GenBankAP0149571e-85AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAY4593381e-85AY459338.1 Oryza sativa (japonica cultivar-group) clone CL029396.2 R2R3-MYB gene region.
GenBankCP0126091e-85CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642897.11e-109PREDICTED: myb-related protein 305
TrEMBLA0A0D9V3C40.0A0A0D9V3C4_9ORYZ; Uncharacterized protein
STRINGORGLA01G0193500.11e-110(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132402633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.11e-55myb domain protein 21